FAM200A Antibody

Name FAM200A Antibody
Supplier Novus Biologicals
Catalog NBP1-60077
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM200A The peptide sequence was selected from the middle region of FAM200A. Peptide sequence QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM200A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.