SC5DL Antibody
| Name | SC5DL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60053 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SC5DL(sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like) The peptide sequence was selected from the N terminal of SC5DL. Peptide sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SC5D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SC5DL Antibody [NBP1-60053] - COLO205 cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6913_SC5DL%2520Antibody-Western%2520Blot-NBP1-60053-img0002.jpg)
Western Blot: SC5DL Antibody [NBP1-60053] - COLO205 cells lysate, concentration 0.2-1 ug/ml.