SERINC2 Antibody

Name SERINC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60102
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SERINC2
Conjugate Unconjugated
Supplier Page Shop

Product images