Name | SERINC2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60102 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SERINC2 |
Conjugate | Unconjugated |
Supplier Page | Shop |