GJC3 Antibody
| Name | GJC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59162 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GJC3 The peptide sequence was selected from the C terminal of GJC3. Peptide sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GJC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GJC3 Antibody [NBP1-59162] - GJC3 Antibody Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15691_GJC3-Antibody-Western-Blot-NBP1-59162-img0003.jpg)
Western Blot: GJC3 Antibody [NBP1-59162] - GJC3 Antibody Jurkat cell lysate, concentration 2.5 ug/ml.