LST3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59440
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LST-3TM12(organic anion transporter LST-3b) The peptide sequence was selected from the middle region of LST-3TM12. Peptide sequence LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLCO1B7
• Conjugate: Unconjugated