GIMAP1 Antibody

Name GIMAP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59488
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GIMAP1(GTPase, IMAP family member 1) The peptide sequence was selected from the N terminal of GIMAP1. Peptide sequence MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GIMAP1
Conjugate Unconjugated
Supplier Page Shop

Product images