C14orf180 Antibody

Name C14orf180 Antibody
Supplier Novus Biologicals
Catalog NBP1-59522
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the middle region of C14ORF180. Peptide sequence PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C14orf180
Conjugate Unconjugated
Supplier Page Shop

Product images