C14orf180 Antibody
| Name | C14orf180 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59533 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the N terminal of C14ORF180. Peptide sequence EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C14orf180 |
| Supplier Page | Shop |
Product images
![Western Blot: C14orf180 Antibody [NBP1-59533] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/255_C14orf180%2520Antibody-Western%2520Blot-NBP1-59533-img0003.jpg)
Western Blot: C14orf180 Antibody [NBP1-59533] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.