OR5T2 Antibody

Name OR5T2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59622
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR5T2(olfactory receptor, family 5, subfamily T, member 2) The peptide sequence was selected from the C terminal of OR5T2. Peptide sequence DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR5T2
Conjugate Unconjugated
Supplier Page Shop

Product images