MS4A14 Antibody

Name MS4A14 Antibody
Supplier Novus Biologicals
Catalog NBP1-59621
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NYD-SP21 The peptide sequence was selected from the middle region of NYD-SP21. Peptide sequence QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MS4A14
Conjugate Unconjugated
Supplier Page Shop

Product images