Solute carrier family 22 member 18 Antibody
| Name | Solute carrier family 22 member 18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60034 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the middle region of SLC22A18. Peptide sequence IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Solute carrier family 22 member 18 Antibody [NBP1-60034] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16892_Solute%2520carrier%2520family%252022%2520member%252018%2520Antibody-Western%2520Blot-NBP1-60034-img0002.jpg)
Western Blot: Solute carrier family 22 member 18 Antibody [NBP1-60034] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.