NKG2E/KLRC3 Antibody

Name NKG2E/KLRC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59933
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLRC3(killer cell lectin-like receptor subfamily C, member 3) The peptide sequence was selected from the N terminal of KLRC3. Peptide sequence MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLRC3
Conjugate Unconjugated
Supplier Page Shop

Product images