Name | MS4A4A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60006 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MS4A4A(membrane-spanning 4-domains, subfamily A, member 4) The peptide sequence was selected from the N terminal of MS4A4A. Peptide sequence MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MS4A4A |
Conjugate | Unconjugated |
Supplier Page | Shop |