MS4A4A Antibody

Name MS4A4A Antibody
Supplier Novus Biologicals
Catalog NBP1-60006
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MS4A4A(membrane-spanning 4-domains, subfamily A, member 4) The peptide sequence was selected from the N terminal of MS4A4A. Peptide sequence MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MS4A4A
Conjugate Unconjugated
Supplier Page Shop

Product images