C1ORF63 Antibody
| Name | C1ORF63 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70455 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C1ORF63 The peptide sequence was selected from the C terminal of C1ORF63. Peptide sequence PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RSRP1 |
| Supplier Page | Shop |
Product images
![Western Blot: C1ORF63 Antibody [NBP1-70455] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/280_C1ORF63%2520Antibody-Western%2520Blot-NBP1-70455-img0002.jpg)
Western Blot: C1ORF63 Antibody [NBP1-70455] - HepG2 cell lysate, concentration 0.2-1 ug/ml.