BEND7 Antibody

Name BEND7 Antibody
Supplier Novus Biologicals
Catalog NBP1-70419
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C10orf30 (BEN domain containing 7) The peptide sequence was selected from the N terminal of C10orf30. Peptide sequence AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene BEND7
Supplier Page Shop

Product images