Name | BEND7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70419 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to C10orf30 (BEN domain containing 7) The peptide sequence was selected from the N terminal of C10orf30. Peptide sequence AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | BEND7 |
Supplier Page | Shop |