ARL17 Antibody

Name ARL17 Antibody
Supplier Novus Biologicals
Catalog NBP1-70411
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARL17(ADP-ribosylation factor-like 17) The peptide sequence was selected from the middle region of ARL17 (NP_001034172). Peptide sequence KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARL17B
Conjugate Unconjugated
Supplier Page Shop

Product images