ALS2CR12 Antibody

Name ALS2CR12 Antibody
Supplier Novus Biologicals
Catalog NBP1-70405
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSAR
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ALS2CR12
Conjugate Unconjugated
Supplier Page Shop

Product images