Name | ALS2CR12 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70405 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSAR |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ALS2CR12 |
Conjugate | Unconjugated |
Supplier Page | Shop |