AGMO Antibody

Name AGMO Antibody
Supplier Novus Biologicals
Catalog NBP1-70404
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM195 (transmembrane protein 195) The peptide sequence was selected from the middle region of TMEM195)(50ug). Peptide sequence AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AGMO
Conjugate Unconjugated
Supplier Page Shop

Product images