ACCSL Antibody

Name ACCSL Antibody
Supplier Novus Biologicals
Catalog NBP1-70401
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACCSL
Conjugate Unconjugated
Supplier Page Shop

Product images