Name | ACCSL Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-70401 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ACCSL |
Conjugate | Unconjugated |
Supplier Page | Shop |