C19orf18 Antibody

Name C19orf18 Antibody
Supplier Novus Biologicals
Catalog NBP1-70444
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C19orf18 (chromosome 19 open reading frame 18) The peptide sequence was selected from the N terminal of C19orf18. Peptide sequence NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C19orf18
Conjugate Unconjugated
Supplier Page Shop

Product images