C16orf71 Antibody

Name C16orf71 Antibody
Supplier Novus Biologicals
Catalog NBP1-70439
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C16ORF71 The peptide sequence was selected from the middle region of C16ORF71. Peptide sequence KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C16orf71
Conjugate Unconjugated
Supplier Page Shop

Product images