NOXRED1 Antibody

Name NOXRED1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70434
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NOXRED1 The peptide sequence was selected from the middle region of NOXRED1. Peptide sequence KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NOXRED1
Conjugate Unconjugated
Supplier Page Shop

Product images