BTNL8 Antibody

Name BTNL8 Antibody
Supplier Novus Biologicals
Catalog NBP1-70424
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BTNL8(butyrophilin-like 8) The peptide sequence was selected from the N terminal of BTNL8. Peptide sequence MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BTNL8
Conjugate Unconjugated
Supplier Page Shop

Product images