CEACAM19 Antibody

Name CEACAM19 Antibody
Supplier Novus Biologicals
Catalog NBP1-70494
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CEACAM19(carcinoembryonic antigen-related cell adhesion molecule 19) The peptide sequence was selected from the middle region of CEACAM19. Peptide sequence MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLP
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEACAM19
Conjugate Unconjugated
Supplier Page Shop

Product images