BAL/PARP9 Antibody

Name BAL/PARP9 Antibody
Supplier Novus Biologicals
Catalog NBP1-70754
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PARP9(poly (ADP-ribose) polymerase family, member 9) The peptide sequence was selected from the N terminal of PARP9. Peptide sequence LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PARP9
Supplier Page Shop

Product images