WDR21B Antibody

Name WDR21B Antibody
Supplier Novus Biologicals
Catalog NBP1-70743
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR21B(WD repeat domain 21B) The peptide sequence was selected from the middle region of WDR21B. Peptide sequence HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DCAF4L1
Conjugate Unconjugated
Supplier Page Shop

Product images