SLFN12 Antibody

Name SLFN12 Antibody
Supplier Novus Biologicals
Catalog NBP1-70707
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLFN12(schlafen family member 12) The peptide sequence was selected from the middle region of SLFN12. Peptide sequence KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLFN12
Conjugate Unconjugated
Supplier Page Shop

Product images