UFSP2 Antibody

Name UFSP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70740
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C4ORF20 The peptide sequence was selected from the middle region of C4ORF20. Peptide sequence YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UFSP2
Conjugate Unconjugated
Supplier Page Shop

Product images