TCTEX1D4 Antibody

Name TCTEX1D4 Antibody
Supplier Novus Biologicals
Catalog NBP1-70719
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RP11-269F19.9 (Tctex1 domain containing 4) The peptide sequence was selected from the middle region of RP11-269F19.9. Peptide sequence VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TCTEX1D4
Conjugate Unconjugated
Supplier Page Shop

Product images