OR11H12 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70664
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to OR11H12(olfactory receptor, family 11, subfamily H, member 12) The peptide sequence was selected from the N terminal of OR11H12. Peptide sequence CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: OR11H12
• Conjugate: Unconjugated