CXorf66 Antibody

Name CXorf66 Antibody
Supplier Novus Biologicals
Catalog NBP1-70511
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CXorf66(chromosome X open reading frame 66) The peptide sequence was selected from the middle region of CXorf66. Peptide sequence PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CXorf66
Conjugate Unconjugated
Supplier Page Shop

Product images