CNTNAP3 Antibody

Name CNTNAP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70503
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CNTNAP3(contactin associated protein-like 3) The peptide sequence was selected from the middle region of CNTNAP3. Peptide sequence GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNTNAP3
Conjugate Unconjugated
Supplier Page Shop

Product images