CES7 Antibody

Name CES7 Antibody
Supplier Novus Biologicals
Catalog NBP1-70498
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the N terminal of CES7. Peptide sequence SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CES5A
Conjugate Unconjugated
Supplier Page Shop

Product images