MUC3B Antibody

Name MUC3B Antibody
Supplier Novus Biologicals
Catalog NBP1-70644
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MUC3B(intestinal mucin MUC3B precursor) The peptide sequence was selected from the N terminal of MUC3B. Peptide sequence MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MUC3B
Conjugate Unconjugated
Supplier Page Shop

Product images