Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody
| Name | Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54829 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SULT1B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-54829] - Titration: 0.2-1 ug/ml, Positive Control: Human Intestine.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16961_Cytosolic-Sulfotransferase-1B1-SULT1B1-Antibody-Western-Blot-NBP1-54829-img0004.jpg)
Western Blot: Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody [NBP1-54829] - Titration: 0.2-1 ug/ml, Positive Control: Human Intestine.