GRPEL1 Antibody

Name GRPEL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54665
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GRPEL1(GrpE-like 1, mitochondrial (E. coli)) The peptide sequence was selected from the N terminal of GRPEL1. Peptide sequence NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GRPEL1
Conjugate Unconjugated
Supplier Page Shop

Product images