RFPL4B Antibody

Name RFPL4B Antibody
Supplier Novus Biologicals
Catalog NBP1-55032
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RFPL4B
Conjugate Unconjugated
Supplier Page Shop

Product images