Name | Mitocondrial Translational Initiation Factor 3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54978 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MTIF3(mitochondrial translational initiation factor 3) The peptide sequence was selected from the middle region of MTIF3. Peptide sequence AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | MTIF3 |
Supplier Page | Shop |