Mitocondrial Translational Initiation Factor 3 Antibody

Name Mitocondrial Translational Initiation Factor 3 Antibody
Supplier Novus Biologicals
Catalog NBP1-54978
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTIF3(mitochondrial translational initiation factor 3) The peptide sequence was selected from the middle region of MTIF3. Peptide sequence AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MTIF3
Supplier Page Shop

Product images