TRIM49 Antibody
| Name | TRIM49 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55024 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TRIM49 (tripartite motif-containing 49) The peptide sequence was selected from the middle region of TRIM49. Peptide sequence VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRIM49 |
| Supplier Page | Shop |
Product images
![Western Blot: TRIM49 Antibody [NBP1-55024] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/377_TRIM49%2520Antibody-Western%2520Blot-NBP1-55024-img0003.jpg)
Western Blot: TRIM49 Antibody [NBP1-55024] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.