DKFZp566F084 Antibody

Name DKFZp566F084 Antibody
Supplier Novus Biologicals
Catalog NBP1-55200
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RP11-529I10.4(deleted in a mouse model of primary ciliary dyskinesia) The peptide sequence was selected from the N terminal of RP11-529I10.4. Peptide sequence MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DPCD
Conjugate Unconjugated
Supplier Page Shop

Product images