METTL10 Antibody
| Name | METTL10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55186 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LOC399818 The peptide sequence was selected from the N terminal of LOC399818. Peptide sequence SSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFRE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | METTL10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: METTL10 Antibody [NBP1-55186] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16048_METTL10-Antibody-Western-Blot-NBP1-55186-img0004.jpg)
Western Blot: METTL10 Antibody [NBP1-55186] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.