Name | XTP3TPA Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55335 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | DCTPP1 |
Supplier Page | Shop |