XTP3TPA Antibody

Name XTP3TPA Antibody
Supplier Novus Biologicals
Catalog NBP1-55335
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene DCTPP1
Supplier Page Shop

Product images