EXOD1 Antibody

Name EXOD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55302
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EXOD1 The peptide sequence was selected from the N terminal of EXOD1. Peptide sequence GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ERI2
Conjugate Unconjugated
Supplier Page Shop

Product images