FAM35A Antibody
| Name | FAM35A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55509 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FAM35A(family with sequence similarity 35, member A) Antibody(against the N terminal of FAM35A. Peptide sequence PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FAM35A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM35A Antibody [NBP1-55509] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17324_FAM35A%2520Antibody-Western%2520Blot-NBP1-55509-img0002.jpg)
Western Blot: FAM35A Antibody [NBP1-55509] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.