CCDC54 Antibody

Name CCDC54 Antibody
Supplier Novus Biologicals
Catalog NBP1-56379
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC54(coiled-coil domain containing 54) The peptide sequence was selected from the N terminal of CCDC54. Peptide sequence MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC54
Conjugate Unconjugated
Supplier Page Shop

Product images