| Name | MPV17L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56328 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MPV17L(MPV17 mitochondrial membrane protein-like) The peptide sequence was selected from the N terminal of MPV17L. Peptide sequence MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MPV17L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |