RFPL2 Antibody

Name RFPL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56360
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RFPL2(ret finger protein-like 2) The peptide sequence was selected from the C terminal of RFPL2. Peptide sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RFPL2
Conjugate Unconjugated
Supplier Page Shop

Product images