ROPN1B Antibody

Name ROPN1B Antibody
Supplier Novus Biologicals
Catalog NBP1-56358
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ROPN1B(ropporin, rhophilin associated protein 1B) The peptide sequence was selected from the N terminal of ROPN1B. Peptide sequence DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ROPN1B
Supplier Page Shop

Product images