LCN8 Antibody

Name LCN8 Antibody
Supplier Novus Biologicals
Catalog NBP1-56314
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LCN8(lipocalin 8) The peptide sequence was selected from the N terminal of LCN8. Peptide sequence EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LCN8
Conjugate Unconjugated
Supplier Page Shop

Product images