OPA3 Antibody

Name OPA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-68964
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OPA3 (optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)) The peptide sequence was selected from the C terminal of OPA3. Peptide sequence SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEEL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OPA3
Conjugate Unconjugated
Supplier Page Shop

Product images